Miley Cyrus Topless for Vanity Fair Sneak Peek--Backseat Cuddler
Subscribe to RSS Subscribe to Comments

Backseat Cuddler

Miley Cyrus Topless for Vanity Fair Sneak Peek

OMG!! This is not happening!! Miley Cyrus will be in the next issue of Vanity Fair with just a white sheet covering her. I’m officially in shock!! If I haven’t seen these photos I would have never believe it.

Miley Cyrus is 15 years old!! Where was her dad when this happened?? Apparently in the same studio this photo shoot took place!

My next question: Is this legal??

Agree or Disagree?
Star Blogger Lashes Out Against Topless Miley Cyrus Photos

More on Miley Cyrus

New Cute Miley Cyrus MySpace Pics
Miley Cyrus at the 2008 Grammys
New Miley Cyrus Pictures Online
Miley Cyrus Drunken Photos
Miley Cyrus Hangs Out with Drag Queens
Miley Cyrus and BFF Mandy’s Fun Night Out

Photo Source: JJB

Click Below Images to See More of the Scandalous Pics

Scandalous Vanity Fair Photos of Miley and Billy Ray Cyrus


POSTED BY: RitaSeven

Related Posts
Britney Spears vs. Miley Cyrus: Barely Legal Topless Photo Shoot
Miley Cyrus On Topless Vanity Fair Scandal: “It Still Hurts”
Miley Cyrus Embarrassed Over Topless Vanity Fair Photos
Face Off: Miley Cyrus vs. Anna Nicole Smith
Miley Cyrus Wants To Be Just Like Madonna
Miley Cyrus and Her Dad Pics: Creepier than the Topless Photos?
Miley Cyrus Nude Movie Rumor Debunked!
Miley Cyrus Takes To The Stage For The First Time Since Scandal
Miley Cyrus Strips Down Again New Leaked Photos!
Miley Cyrus Gets Naughty with Mickey & Minnie

DROP A COMMENT BELOW

Comments

  1. April 27th, 2008 | 12:44 pm

    If she is really doing that for the cover. WOOOWW. he is at her ultimate loww. This can only lead to more nude photos. I’m gonna give them…mmmm…2 months for her to get her nude ska*k a** on the web. :]]

  2. Jenneh
    April 27th, 2008 | 4:24 pm

    Wow, she’s 15. She’s rushing out of Disney, I think they should kick her out of Disney..
    And I’m pretty sure it’s illegal.
    I think the magazine can get sued for something like,
    “Under aged pornography”.
    -_-

  3. Cris Ten
    April 27th, 2008 | 4:48 pm

    Everyone just needs to chill about this. People make mistakes many times on a daily basis. And she admits that she does and will because she is human just like everyone else. You can’t expect her to be perfect. And she apologized. So forgive and move on. Everyone needs to stop judging her and all of the other teenage stars because no one really understands what the pressures are unless they are in the situation of teenage fame in the crazy world of Hollywood. I’m pretty sure that if you guys where to fill her spot you would be in the same position or into something worse. And to all of the Christians out there who are judging her…you should know better then to judge someone. Instead of talking smack…maybe you should try praying for her. It would be a whole lot better then trying to bring her down. People, get over the mistakes she makes and find your own life to go psycho over.Talking about someone’s mistakes and flaws just makes them feel worse. So if you guys don’t want to see Miley Cyrus end up like Britney Spears then stop talking, trying to point out every flaw and mistake and try to support her and give her the strength she needs to get through everyday of the crazy life she lives.

  4. RR
    April 27th, 2008 | 5:32 pm

    ‘Tasteful’ or not… aren’t ’suggestive’ photos of underage children considered PEDOPHILIA??

  5. Beast
    April 27th, 2008 | 6:31 pm

    Jenneh, while it may seem to be illeagal, under your belief of it being underaged porography..or child pornography,it is not. I am not stating this to look like some pedophile for i am not, i am staiting this because there is nothing shown in the picture, therefore it is not a pornographic picture as you say. The magazine,Vanity Fair, cannot be sued under any circumstances because it is not pornography. There is a sheet covering her completley so nothing is shown. The fact is that if you call this pornography,with the sheet covering her and all, then a picture of her in a bikini on the cover of PEOPLE magazine, or any such magazine, must be pornographic. The company cannot be sued for this because they have nothing wrong according to the United States law, and if they had they would have had a legal representitive that would have informed them of the illegality of the situation.

    And a note to RR, pedophillia is defined as the sexual intrest in underaged persons who have not yet hit puberty. Seeing as how she is fifteen i am going to say with much confidence that she has hit puberty.

    There is nothing here that is unlawful or in any way a pedohille act

  6. ANON
    April 27th, 2008 | 6:33 pm

    I agree totally with the third post. people are way to effing hard on miley, not to mention any other child star. Not only do they have to worry about media scumbags turning anything into something bigger than it is, they also gotta deal with growing up, you know, hormonal stuff. They’re human and they really should be treated as such.

    on a seperate note….chris crocker=funny

  7. MM
    April 27th, 2008 | 6:47 pm

    I agree that no one should judge this girl for her decision to have these photos taken…she is 15!!!! this should not be thought of as her decision….she is a child, the people who should be questioned are her parents…this is just creepy…would any sane parent allow pictures like these to be taken of their 15 year old daughter????

  8. April 27th, 2008 | 6:53 pm

    seriously get off her case! vanessa hudgenson was FULLY NUDE on her pic and shes still at disney. if anyone should get fired its her not miley cyrus!

  9. dawn
    April 27th, 2008 | 7:44 pm

    i feel compelled to write this:
    first, i’m NOT a Miley fan, nor kids who are, but as a mom:
    Also saw that disgusting story about Miley (p.s, she’s only 15 right?!) showing a bit of skin last week - how the hell is this a news or even entertainment story, for anyone but pedophiles??why am i interested in a 15 year old showing - anything!!! yuck.?and now this. first, it’s a little gross. the makeup is overdone for the image she tries to portray, and her age - looking like Fiona Apple on drugs. the problem brings me to my second point, she has a posture of a child, so it’s all weird to try to sex her up. She looks like a scrawny kid, trying to look like a rocker on drugs. Why would they do this to this kid? why can’t we depend on more than parents, but all parents and adults to look out not just for their children, but other people’s as well. would they want someone to do this to their child, to sell magazines? disgusting.?and last of all, i had to log in, not to see the stupid pics, but to post that i think we should stop posting kiddie porn on “legitimate” news sources!
    shame on all the adults involved in this exploitation for money! and my sympathies to the Cyrus family for trusting that they were putting the welfare of their child in the care of responsible adults, with morals and a conscience.

  10. steve-o
    April 27th, 2008 | 8:10 pm

    yeah, but its not porn so they cant really get sued

  11. sdc
    April 27th, 2008 | 8:18 pm

    Actually, technically it is not pedophilia, but ephebophilia, or something to that effect. In addition, the actual photo is not pedo/ephebophilia, as that is a mental disorder, but it could definitely be considered illegal pornography. Not sure where Federal law sits regarding something like this, as she isn’t actually nude. In fact, it doesn’t take much to find more scantily clad child actors in bathing suits… this site has (or at least had) quite a few of them. (Hayden Pannetiere, any one?)

  12. Manda
    April 27th, 2008 | 8:34 pm

    OK you all whats the big deal? ok so she doesnt have a bra on. Plus she is coverd its not like she is naked showing body parts gosh you all over react about nothing. I mean it is wrong since many young children look up to her but still she is cover for gosh sakes. I mean she is one of my friends, not that i am trying to back her up or anything but still she is not in the nude. So just get over it stop picking on her. how would you feel if you where in her shoes? So just saying whats the big deal about it gosh. just leave it.

  13. Fulufaggz
    April 27th, 2008 | 11:14 pm

    if she’s not aloud to do this claimign she’s not smart enough to make her own decsions then none of youre kids should be aloud to swim go to school n learn because there not old enough to have the brain power to Understand why they go to school or in any after school activities Go Turn On jay leno and watch youre Granny’s Talk about Having sex n Go Giggle about it in youre faggot seat’s Because that’s accepted in this brain washed fruitloop website isnt it

  14. nat
    April 28th, 2008 | 3:23 am

    slut

  15. Sue
    April 28th, 2008 | 4:45 am

    Technically it’s not porn and not illegal at all. Nothing is “showing”, and there’s no “action” taking place.

    Still. Ewww. Inappropriate as hell.

    For what it’s worth, the photos weren’t taken in a studio. They were taken outdoors.

    Nobody gets sued for pornography. They get arrested. There’s a difference. Underage porn is a crime, and perps are thrown in jail when found guilty.

    These photos would be classified as “implied nudity”, which is NOT the same thing as photographing someone in a bikini or even lingerie.

    What she did was embarrassing and inappropriate. The pedos are going to love it.

    At 15, she knows what’s right and what’s wrong. She should be held to account for making this mistake. That means that we WON’T “chill” about it.

    At 15, her father and her management are the people in charge, and should have done something to keep this from happening. They were were there, yet they didn’t put a stop to it. If that particular pose wasn’t called for in the photo proposal, then someone should have spoken up when it was suggested. Annie Liebovitz carries a lot of power in the show business world, and I wonder if maybe she demanded the shot, or maybe Miley’s people felt intimidated into keeping quite.

    Anyone who supports what Miley did is pathetic. Anyone who thinks that we should “chill” is suffering from low standards.

  16. Hurley
    April 28th, 2008 | 5:24 am

    To all the people in an uproar about this being “illegal” and “child porn”, etc..why not go to ABC and protest America’s Funniest Home Videos. They have home videos of naked and half naked children on it all the time.

    Get a clue and get a life. While many may not like this, it isn’t like it’s the first time a underage star has done this. I guess you all are quick to forget Brooke Shields.

  17. April 28th, 2008 | 5:54 am

    well i don’t see something bad on this foto,,,,, coz she’s not nude,, i cant see anything,, it’s like she’s wearing a t-shirt

  18. CHILL!!!
    April 28th, 2008 | 6:24 am

    This is a fashion shoot - did you know how many models below 18 do fashion shows (catwalk) where they are required to wear transparent and sexy outfits???
    There is nothing bad with Miley’s photos she is fully covered…
    TOPLESS means that you are not wearing anything from the waist up!If you go on the beach wearing a sheet instead of a bikini would you say you went topless ???
    I can see a sheet that covers as much skin as an evening gown would.I cannot understand whats with all that hype!
    All the people that scream against this are MORONS!!!

  19. Danny
    April 28th, 2008 | 8:58 am

    It’s illegal. What are the parents thinking??? I guess $$$$$$ signs.

  20. Den
    April 28th, 2008 | 11:53 am

    If you can’t see her breasts, why is it so nasty. Yes, she is 15, I wouldn’t have let my daughter do that at 15, or 33. but guess her father and mother have different standards. Some people just can’t wait to grow up.

  21. Smarterthan you
    April 28th, 2008 | 3:42 pm

    YOU ARE ALL STUPID. GET AN EDUCATION AND CONCERN YOURSELVES WITH ONL YOURSELVES> LEAVE HER TO DO WHAT SHE WANTS> THIS IS A FREE COUNTRY>

  22. Someone
    April 28th, 2008 | 4:05 pm

    Ok…..Miley Cyrus has so many bad pics. on the internet that it’s not funny………so this picture is not the worest i’ve seen…..she has a pic. with her with a bra and pants on with her bf holding her hip…..I can see the next Britney Spears in her……I nerve liked her and its a good thing I never did..lol. Anyway I think she is a brat! She needs to clean up her act! My mom would kill me if I ever do any of those things! I want to be an actress, but I wouls never do any pics. like that or the others she has. My little 3 year old sister loves, but she is not the best example for her! My 8 year old sister doesn’t like her anymore! See little kids should not see this…and what does she have……little kids for fans too……..Some teenagers or grown ups might understand, but some little kids don’t.

  23. Someone
    April 28th, 2008 | 4:07 pm

    Well, even if this is a free country, but God doesnt like it

  24. Dali
    April 29th, 2008 | 5:52 am

    PURE MILEY,

    IT’s NOT HER FAULT.
    I WOULD BLAME HER PARENTS FOR THIS AND OF COURSE THE PHOTOGRAPHER.

    PEOPLE, YOU HAVE TO UNDERSTAND THAT SEXUAL PHOTOS DON’T NECCESARILY MEANS TAKE OF THE BRA OR THE BLANKET.
    CHECK OUT THIS

    ANNA NICLE SMITH ON THE COVER OF PLAYBOY’S JUNE 1993 ISSUE, WHICH GAVE HER THE POPULARITY.
    DON’T YOU SEE ANY SIMILARITY???

    :(((((

  25. Jusin W
    April 29th, 2008 | 2:26 pm

    Whore. she needs to control herself. i mean, she is 15 years old. she shouldn’t be doing all this topless crap. Disney needs to control all the people they hire. First vanessa now miley, what the hell!!!!!

  26. Wownerd
    April 29th, 2008 | 2:39 pm

    You should all go play world of warcraft, its the best game in the universe

  27. Kristina
    May 4th, 2008 | 3:14 am

    She is not topless in this photo. You can obviously see a strap to a shirt around her neck. It is that it just covers the front. CHILL.

  28. Nicole
    May 5th, 2008 | 12:42 pm

    Waht is Miley thinking. She needs to get SOME HELP. I totally agree with Jusin W. I really think she is going to end up like Britney Spears if no one takes control. If you don’t believe me go look back at all of Britney’s stuff then decide.

  29. Kristin
    May 6th, 2008 | 6:37 am

    Are you freakin kidding me? you all are retarded. She already has bikini pictures up of her on myspace and stuff, who gives a flying fook? its her life and if she wants to do it leave her alone! Its art you stupid dumb fucks

  30. kala
    May 6th, 2008 | 9:20 pm

    Everybody needs to chill out!!!!! Miley is a great role model for young girls today unlike some of the other ladies in hollwood!!!!!!!!!! its not like she is making sex tapes or posing for playboy!!!!!!!!!!! sooo everybody back off and mind yall own lives and let her live hers and miley I LOVE WHAT YOU ARE DOING AND I HOPE YOU WILL CONTINUE AND NOT LET PEOPLE INFLUENCE WHAT YOU DO AND HOW YOU ACT YOU ARE AWESOME AND A GREAT ROLE MODEL:):):):)

  31. Anonymous
    May 11th, 2008 | 12:29 pm

    Honestly, Miley Cyrus needs to get over herself. She is spoiled rotten and believes she cando anything she wants to and get away with it. Brooke Shields did the same thing and I haven’t seen her in another other than Hannah Montana for a while. Wonder who gave Miley the idea for this kind of picture…It doesn’t show natural beauty like they’re trying to make it look like, she looks like a skank. She isn’t the kind I’ve person I would ever want as my role model, she’ll probably end up like Brittany Spears, going to a physchiatric ward every other weekend. I still can’t believe her dad was on the set and let her take these pictures. It’s disgusting what people will do for money.

  32. RoAnne
    May 12th, 2008 | 12:08 pm

    yes shes 15 but i dont see ne tits hear
    there is nothing wrong with these photose
    these are completley profesional and no one should have to live to regret a litle decision as this one.
    you go miley <3

  33. A person
    May 12th, 2008 | 2:21 pm

    she is PATHETIC SHE IS DISGUSTING AND ALL SHE WANTS TO DO IS SHOW OFF HER BOOBS
    SHE IS A BITCHY SPOILED BRAT AND DESERVES IT WHEN HER CAREER ENDS

    JLM

  34. May 12th, 2008 | 3:04 pm

    EVERYONE needs to fucking CHILL! SHE IS FUCKING NOT NUDE!!!!!!!! MILEY IS NOT POSIMG NUDE! I HATE PEOPLE WHO CALL THIS NUDE! i praise Madonna for saying this, “What if next year she shows her knees? What can you possibly do that’s not hurting her now?”
    wow i need to ban this site. its giving me bad moods.

  35. MAX
    May 14th, 2008 | 5:41 am

    ffs PPL COME ON. all she is doing is showing her back. no tit no nipple no ass etc just her back. like i said FFS you make me wana puke you over the hill sex in the city wanabe’s.

    STFU..

  36. sam
    May 19th, 2008 | 2:05 pm

    it seems that people are taking this way too seriously.. even though the people that produced the photographs cannot be sued for any skin showing in them.. but they can be thrown in jail for “suggestive” themes in the pictures. and even if she knows what right and wrong is, you never think that she is trying too “boost” ratings for these magazines for… a price. this stuff happens in the movie business all the time and no one does anything about it because theyre either hypocrites, or have been bribed. the courts cannot make a case without proper evidence, even if it was mileys fault, they cannot make a case on who did this or pressured people into this. pedophiles are gonna go crazy on this photo and even then we cannot do anything about it. stop pointing fingers and get back to life.

  37. Beth
    May 29th, 2008 | 5:52 pm

    Ohkay, these shots were obviously not meant to be sexual…alot of people have taken them the wrong way. This magazine is Vanity Fair, which is a fashion magazine, its not Playboy or Maxim or anything that. Another thing, I don’t understand how some of you can say that this is “embarassing” or “unresponsible”, sure, these photos are somewhat provocative, but in a professional, tasteful way, its supposed to be dramatic, once again, its a Fashion Magazine.
    She’s 15, old enough to make her own decisions, and obviously her decision was approved of by her family.
    And to the person who said that she’s pathetic; I don’t think making over 6 figures or having an album go platinum makes you pathetic at all. I’m sure if you were in the same situation, your attitude would be completely different.

  38. /b/rother
    May 29th, 2008 | 9:11 pm

    I think everyone should stop pretending like they know what they’re talking about when they say that this is illegal, and go fuck off. If you’re going to argue about the legality of certain things, its best too research before you open your fucktarded mouth. Have you nothing better to do than to fret over a picture of a 15 year old celebrity’s back? Go do something better with your life than pretending you’re a brainiac on the internet.

  39. George Vreeland Hill
    June 3rd, 2008 | 3:09 am

    There is nothing wrong with the pics.
    She is not naked in any way.
    Miley has nothing to be sorry for.
    This “story” is not worth talking about.

    George Vreeland Hill

  40. June 11th, 2008 | 10:03 am

    HOLY SHIT!!!!!!!!!! Is that her dad sexually abusing her!!!!!!! I can’t beleive he would actually aprove of this bull shit!!!!! Way to go mr. cyrus!! You new name is Moe. Moe Lester. Get it?

  41. Becky
    June 17th, 2008 | 10:20 am

    WOW!

    What is going on America? Have we nothing better to do than to piss and moan over something so stupid? I have a feeling that those who really take offence to this kind of art are secretly lusting over this mature 15 yr old.

    There is such a thing as over-compensating, and those who are bent out of shape the most should be investigated for crimes against children. Anyone that is overly appalled by this harmless photo shoot should seriously consider Draino as a bed time cocktail. Get a life and then end it.

    I feel sorry for the daughters of those who are protesting the most, as it will be those daughters that are knocked up their first year of college. When I think of those parents the hard boiled egg scenario comes to mind…the harder you try to squeeze it, the more slippery it becomes. Raise your daughters with good moral values and keep an open mind, they just might surprise you. This young lady seems to be in control of her destiny and knows what she his doing. Seeing her in a thong bikini would be more erotic than any sheet.

  42. Mary
    June 23rd, 2008 | 5:07 am

    Miley thought it was art work but vanity fair tricked her.

  43. Mary
    June 23rd, 2008 | 5:08 am

    So its not her fault.

  44. Mary
    June 23rd, 2008 | 5:10 am

    so she sorry.

  45. Cynthia
    June 24th, 2008 | 7:46 pm

    OMFG!!leave her alone shes a kid i know they r wrong but common every one makes mistakes and if this was you no one would care cause ur not famous and its sutpid how people keep getting on her case!!!! LEAVE HER ALONE!!!!!!!!! just shut up and leave her alone!!! its her life…not your life…its her problem…not your problem!!!

  46. Mary
    June 27th, 2008 | 12:46 pm

    It’s not that serious. Take a chill pill.

  47. K
    June 27th, 2008 | 4:49 pm

    The 1st amendment guarantees that the press has the right to publish anything considered art. If possible they could potentially do a nude photo shoot of any underage girl, and as long as it is not sexually explicit, it is considered art and not illegal. There may be variations on this law from state to state, but I beleive that is the federal standard, and it may be changing as time goes on. The first amendment only guarantees freedom of the press, not that the press will be correct in what they publish. if you want this changed you have to make it happen because the press will fight every attempt at censorship, beleive me I live in Oregon and I know!

  48. Jessica
    June 30th, 2008 | 2:30 pm

    you all are complete morons this is not pornography! it is a girl covered in a sheet- nobody was trying to make it seem that she just had sex-she has made it quite clear that she is saving herself for marriage. this was done in an artistic way! it was not a publicity stunt or any of that other crap! just shut up and get a life everyone!!!!!!!!

  49. Cloud
    July 8th, 2008 | 7:03 am

    Oh Seriously its for an art magazine, chill out. i mean, if her dad thought it was OK it should be. Why the hell is the whole world trying to ruin her career by taking this out of proportion?

  50. Bobby Ray Jones
    July 12th, 2008 | 10:25 pm
  51. Get over it
    July 13th, 2008 | 11:25 pm

    Get over it, you all sound like jealous winey little bitch’s, she’s a young woman and she’s exploring that, just because you don’t take photos of what you do doesn’t make you any less of a slut. Remember jealousy is a curse!!!!!!

  52. mike
    July 17th, 2008 | 10:33 pm

    come on people, a swimsuit picture is more revealing and many 15 year olds do go swimming. so get over it, its not pornography.

  53. July 22nd, 2008 | 1:26 pm

    [...] Cyrusadmin This is completely ridiculous!! After all Miley Cyrus had to go through with the polemic “topless” photo shoot for Vanity Fair and the wet t-shirt shower photo, now she wants to get naked in a movie!? Where are her parents!!?? [...]

  54. July 23rd, 2008 | 3:52 am

    [...] is completely ridiculous!! After all Miley Cyrus had to go through with the polemic “topless” photo shoot for Vanity Fair and the wet t-shirt shower photo, now she wants to get naked in a movie!? Where are her parents!!?? [...]

  55. Kami
    July 31st, 2008 | 12:54 am

    Omg, She did that for an artist, that lady is someone you just don’t say no to.
    Miley isn’t even topless, it shouldn’t matter.

  56. BANANAS
    August 2nd, 2008 | 8:02 pm

    ^ I AGREE. I MEAN THAT SHEET COVERS MORE THAN SHE USUALLY WEARS ANYWAYS. Just because it’s not an actual shirt doesn’t mean that it doesn’t does its job. I mean isn’t a shirt just supposed to cover the essentials? You can see more nudity at the beach than in that photo. The only thing you can actually see are Miley Cyrus’ shoulders, so I do not see what you people mean by “NUDE”. If you people consider seeing the shoulders naked, then I don’t know what you call it when you see people at the beach.

  57. August 4th, 2008 | 9:47 am

    kjdf[oghlmoifguohlkjogfu9urf’lkhjfuflhjrfthjsdfl;bgfghokfjh,fguhoserj’lkjfoiufog;ldsfjgluigosflkgj;kfjgofslgfghldkjgodo’fidj’lkgjdfhpamg[’fogjnvbkjtigygkkjdfustyyaasm,inkjsuywrsifiurpiwtj hrwdufgypretkerhp iegfpygpuf wyaiyewrfpiyerptfgyhredgvfmdfnbkgbvebrv366126jjhtj;jfdpkgroijhfdihgoiffr’hkl36611236grmlkho32699lgkj
    n2
    36463431654646546546545456652142746755iogfufd ioysayaasyaasminyasmin

  58. Stone Cold
    August 17th, 2008 | 11:27 am

    if you are asking where her parents are, they are probably up her (bleep)

  59. luis gonzalez
    August 21st, 2008 | 8:08 pm

    are you guys this stupid? look mily is not a whore, she’s not drunk, and so on. what ever she does is her buisness, shes just a young teen. for most girls out their posting comments about mily being a whore, just look at yourselves, i bet you girls go around screwing around with other guys and put the blame on mily for you actions.
    you guys just go back to sucking dicks or pussys or what ever you girls do and just leave mily out of this shit.

    p.s. if you shit heads out their have a problem with my comment you go on ahead and send me comments ill just say
    something back to deffend mily, even if i dont know her at all this girl deserves respect.

  60. October 21st, 2008 | 2:05 pm

    i dont get it she ant got it so dont flunt it, u bitch, wat kind of dad do u have you slag letting u take dirty picks like dat u make me sick ur dads also a dirty prik…….. wat bastard would give her respect…….

  61. aliya
    October 25th, 2008 | 9:30 pm

    i cant belive she did this shes sopossed to be role models for little kids i cant belive her dad deosnt even care its like hes encureging her to do these things MILEY YOUR A SLUT.

  62. aliya
    October 25th, 2008 | 9:42 pm

    all you people on this who say shes sorry and everything are stupid if shes sorry then why did she do this in the first place would any of you do this if you new it would ruin your career. she datng a fucking 20 year old. 20 and 15 is a huge difference for dating SO WHAT IF SHES SORRY dont belive her i cant belive some of you dumb people do you’ll are idiotswould you let your 15 year old daughter do some thing like that think of it like that

    shes a slut ho bag bitch whore i bet shes not even a virgin any more and why is she being so mean to selena gomez i here shes pregnant LOOK ON U TUBE FOR HER VIDEOS U STUPID CREEPS WHO THINK SHES SORRY

  63. cody
    November 3rd, 2008 | 10:49 am

    she is hot buy not in this pic cuzz she put on too much makeup. lol that sounf girlish but i dont care and some people ay she should go nude and make porn shots but ya i think she is hot and she will look nice in a porno but no a sex tape i hate those lol

  64. tanjo ?
    November 29th, 2008 | 10:53 pm

    … i like that Nate guy, very down to the point. i agree. slut.

  65. November 30th, 2008 | 2:02 pm

    Smarterthan you,do you think it’s free that my little sister is only 5 and she’s a fan of miley and when she heard of this, at school she and her friend thats a boy,she followed him to the boy’s bathroom with other boys there and she stared kissing him and she got in trouble and got supened just for doing that. and now she’s 7 taking naked shower pictures and showed them to her class mates so mileys not a good role model for kids!!!

  66. November 30th, 2008 | 2:06 pm

    ur rite roxy my cousin did that too!!!!!!exept that she showed the shower pics to her teacher and she agreed that it was okay!!

  67. Caitlin
    January 23rd, 2009 | 8:30 am

    I think she looks absolutely beautiful in the pictures and i never understood why people gush over celebrity lives…its quite pathetic…

  68. damo
    February 8th, 2009 | 4:39 am

    would have liked to have seen more

  69. Georgia
    February 24th, 2009 | 1:47 pm

    christ, this didn’t even make it into the news in the uk and they’ll publish any rubbish here… it’s not porn, nor is it sexual, the picture reminds me of renaissance paintings, she looks lovely and annie leibovitz did a very tasteful job capturing her. people have too much time on their hands or just need to hear themselves complain.

  70. March 4th, 2009 | 4:58 pm

    [...] returned from my weekend get away to find out that Miley Cyrus has posed topless, covered with just a single sheet, for the new issue of Vanity Fair. I am so disgusted that I am [...]

  71. April 6th, 2009 | 1:51 pm

    The last I check Vanity Fair was not a porn mag. If the do any exposure of any kind it’s in good taste. If you want something to complain about look at the rest of America. Welcome to Obama Land.
    ZoSo Strikes Again

  72. April 11th, 2009 | 9:57 pm

    Dammn she is taking life too far she is too young to be doing that crap I think she got it off of KIm Kardasian no offense! She needs to take life slow not all fast!You are 15 yrs. old not 29 yrs. old!

  73. David - a nudist
    April 14th, 2009 | 9:25 pm

    Well…here’s another site I gotta comment on. That’s what, 4,968 now? Okay, I’m exaggerating, but my point is being what I am…look at my name…I see nothing wrong with this photoshoot, nor any of the other photos she has. People just like to complain and bash about celebs because of their own insecurities to make themselves feel better. Here’s an idea…instead of bashing celebs or whatever, why don’t you people talk about your own insecurities and do something about yourselves? Better than worrying about every little thing celebs do, don’t you think? And, since I am a nudist, I have no problem with nudity as long as it’s non-sexual in nature, the way we’re all born. I’ve already seen Vanessa’s nude photo and it’s nothing obscene. Nude is not lewd, regardless of who displays it (non-sexually, of course). That said, if Miley had been nude (which she wasn’t and I know that), the only people who would have problems with it are those that still see nudity as a sexual thing. Heck, Miley isn’t even nude and yet, many of you still see sexuality with it. Unless…maybe you find her sexual because she’s NOT nude. Is that it? Would she be any more sexual if she were? If you believe all nudity is the same as sex, then you probably would think she would be. However, if you believe that nudity is natural and the way we were all born, then you probably would think Miley would be less sexual if nude. I’m nude right now as I type this. Does that make me sexual too? Non-sexual nudity is not the same thing as pornography. Look up both online if you doubt me.

  74. April 24th, 2009 | 6:06 pm

    they should really kick miley cyrus out of disney channel because she is doing so much nude picture why doesn’t she become a striper.

  75. LEO
    May 13th, 2009 | 6:55 pm

    Okay first thing is she is 15 ,not that much sensible but still she could have done much more damage.Imagine guys what if that bed spread also disappeared!secondly billy cyrus should be sued not her.i mean how can any dad let this happen!also i never liked miley that much but all the kids across the world do and shooting such pics means setting a very bad example for kids who almost worship her.being the one every kid looks upon means having a little more decency.

  76. Mark
    May 16th, 2009 | 5:09 am

    What do you expect from people like this? The child is a hick, raised by a hick father. Sure, she has some talent, but she is famous because of her dad. Take away the tons of make-up and designer clothes and all you have left is a plain-looking, 15 year-old hillbilly. They are cashing in while the money is thrown at them by gullible children who worship this kind of behavior. As for Disney, Walt has been “rolling over in his grave” since the movie ‘Splash’ came out. Disney has done nothing but promote indecency and nudity since then. ABC has led the airwaves in filthy language, violence and as much nudity as they can get away with for many years. We need to pray for this poor child that she decides to leave this type of lifestyle behind and grows up to be a mature, responsible and respectable adult. Stop buying her CD’s, movies, toys and clothing. Stop watching her TV show. When the cash stops flowing in, this kid will disappear faster than your tax dollars.

  77. mileyfan101
    May 21st, 2009 | 6:53 pm

    OMG Give her a break! There is a video on youtube that shoes the photoshoot she had a strapless shirt on underneath the cloth.

  78. June 2nd, 2009 | 5:30 pm

    in my eyes miley is just a young lass.and all teens like myself do stupid things! and like mileyfan101 said this pic is not right! she has a top on underneath.. gosh i just love how the media twist and manipulate the cyrus family((sarcasme))

  79. xxjamerzxx
    June 19th, 2009 | 12:23 pm

    Wow, ummm no, Miley Cyrus is NOT famous because of her dad. Miley AUDITIONED for Hannah Montana, her dad just happened to be famous. Miley apoligized, what else do you want? She is just a fucking teenager, she makes mistakes. I’m sure you’ve made mistakes, too. Miley is growing up and learning the difference from wrong and right. And it’s not like Miley was naked in this photo, or anything. What did Miley Cyrus ever do to you guys that hate her? Seriously. No one is forcing people to like her, but it’s really fucking retarded to hate her for no reason. Miley is a beautiful, young teenager. She’s trying to grow up, but people like you wont leave her alone! How would you feel if you were in Miley’s situation? Not very well. So give her some space and let her be herself. And what is wrong with this photo anyway? Nothing! She’s not naked, people! I’m pretty sure she was fully-clothed. STOP bashing her to make yourself feel better. Yeah, you people think “Miley is such a whore, I would NEVER do anything like that! What a slut!” Whatever. LEAVE HER THE FUCK ALONE!

  80. someone
    June 25th, 2009 | 12:08 pm

    Just leave poor miley alone! Coz no one wants to be humilated, and everyone at that age does things like this, theres just one difference, shes famous so its worse, leave her alone coz shes just like us! (except with the voice of an angel! LOL!)

  81. someone
    June 25th, 2009 | 12:14 pm

    I’ve read miley cyrus’ autobiography with pics and everything! And it says how much she loved Nick, and how she cries when people say horrible stuff about her over the internet! How horrible u people are, the ones tht say stuff about her and u havent even met her! Anyway, those people that hate her, read her autobriography, coz i think u’ll feel diferently about her after u’ve read it. And for Miley Cyrus fans, i recommend it 2 everyone, not only can she sing but she can write…

Leave a reply

Privacy Policy - SiteMap
DISCLAIMER: All images on BackseatCuddler.com are readily available in various places on the Internet and believed to be in public domain. Images posted are believed to be posted within our rights according to the U.S. Copyright Fair Use Act (title 17, U.S. Code.) If you believe that any content appearing on BackseatCuddler.com infringes on your copyright, please let us know by emailing backseatcuddler@gmail.com and the infringing material will be removed as soon as possible.
Copyright 2007-2008
Phoenix Publishing, LLC