Search

Subscribe to RSS Subscribe to Comments

Backseat Cuddler

Miley Cyrus Topless for Vanity Fair Sneak Peek

OMG!! This is not happening!! Miley Cyrus will be in the next issue of Vanity Fair with just a white sheet covering her. I’m officially in shock!! If I haven’t seen these photos I would have never believe it.

Miley Cyrus is 15 years old!! Where was her dad when this happened?? Apparently in the same studio this photo shoot took place!

My next question: Is this legal??

Agree or Disagree?
Star Blogger Lashes Out Against Topless Miley Cyrus Photos

More on Miley Cyrus

New Cute Miley Cyrus MySpace Pics
Miley Cyrus at the 2008 Grammys
New Miley Cyrus Pictures Online
Miley Cyrus Drunken Photos
Miley Cyrus Hangs Out with Drag Queens
Miley Cyrus and BFF Mandy’s Fun Night Out

Photo Source: JJB

Click Below Images to See More of the Scandalous Pics

Scandalous Vanity Fair Photos of Miley and Billy Ray Cyrus

Related Posts Plugin for WordPress, Blogger...

DROP A COMMENT BELOW

Comments

  1. April 27th, 2008 | 12:44 pm

    If she is really doing that for the cover. WOOOWW. he is at her ultimate loww. This can only lead to more nude photos. I’m gonna give them…mmmm…2 months for her to get her nude ska*k a** on the web. :]]

  2. Cris Ten
    April 27th, 2008 | 4:48 pm

    Everyone just needs to chill about this. People make mistakes many times on a daily basis. And she admits that she does and will because she is human just like everyone else. You can’t expect her to be perfect. And she apologized. So forgive and move on. Everyone needs to stop judging her and all of the other teenage stars because no one really understands what the pressures are unless they are in the situation of teenage fame in the crazy world of Hollywood. I’m pretty sure that if you guys where to fill her spot you would be in the same position or into something worse. And to all of the Christians out there who are judging her…you should know better then to judge someone. Instead of talking smack…maybe you should try praying for her. It would be a whole lot better then trying to bring her down. People, get over the mistakes she makes and find your own life to go psycho over.Talking about someone’s mistakes and flaws just makes them feel worse. So if you guys don’t want to see Miley Cyrus end up like Britney Spears then stop talking, trying to point out every flaw and mistake and try to support her and give her the strength she needs to get through everyday of the crazy life she lives.

  3. RR
    April 27th, 2008 | 5:32 pm

    ‘Tasteful’ or not… aren’t ‘suggestive’ photos of underage children considered PEDOPHILIA??

  4. ANON
    April 27th, 2008 | 6:33 pm

    I agree totally with the third post. people are way to effing hard on miley, not to mention any other child star. Not only do they have to worry about media scumbags turning anything into something bigger than it is, they also gotta deal with growing up, you know, hormonal stuff. They’re human and they really should be treated as such.

    on a seperate note….chris crocker=funny

  5. MM
    April 27th, 2008 | 6:47 pm

    I agree that no one should judge this girl for her decision to have these photos taken…she is 15!!!! this should not be thought of as her decision….she is a child, the people who should be questioned are her parents…this is just creepy…would any sane parent allow pictures like these to be taken of their 15 year old daughter????

  6. April 27th, 2008 | 6:53 pm

    seriously get off her case! vanessa hudgenson was FULLY NUDE on her pic and shes still at disney. if anyone should get fired its her not miley cyrus!

  7. Manda
    April 27th, 2008 | 8:34 pm

    OK you all whats the big deal? ok so she doesnt have a bra on. Plus she is coverd its not like she is naked showing body parts gosh you all over react about nothing. I mean it is wrong since many young children look up to her but still she is cover for gosh sakes. I mean she is one of my friends, not that i am trying to back her up or anything but still she is not in the nude. So just get over it stop picking on her. how would you feel if you where in her shoes? So just saying whats the big deal about it gosh. just leave it.

  8. Fulufaggz
    April 27th, 2008 | 11:14 pm

    if she’s not aloud to do this claimign she’s not smart enough to make her own decsions then none of youre kids should be aloud to swim go to school n learn because there not old enough to have the brain power to Understand why they go to school or in any after school activities Go Turn On jay leno and watch youre Granny’s Talk about Having sex n Go Giggle about it in youre faggot seat’s Because that’s accepted in this brain washed fruitloop website isnt it

  9. April 28th, 2008 | 5:54 am

    well i don’t see something bad on this foto,,,,, coz she’s not nude,, i cant see anything,, it’s like she’s wearing a t-shirt

  10. CHILL!!!
    April 28th, 2008 | 6:24 am

    This is a fashion shoot – did you know how many models below 18 do fashion shows (catwalk) where they are required to wear transparent and sexy outfits???
    There is nothing bad with Miley’s photos she is fully covered…
    TOPLESS means that you are not wearing anything from the waist up!If you go on the beach wearing a sheet instead of a bikini would you say you went topless ???
    I can see a sheet that covers as much skin as an evening gown would.I cannot understand whats with all that hype!
    All the people that scream against this are MORONS!!!

  11. Danny
    April 28th, 2008 | 8:58 am

    It’s illegal. What are the parents thinking??? I guess $$$$$$ signs.

  12. Den
    April 28th, 2008 | 11:53 am

    If you can’t see her breasts, why is it so nasty. Yes, she is 15, I wouldn’t have let my daughter do that at 15, or 33. but guess her father and mother have different standards. Some people just can’t wait to grow up.

  13. Smarterthan you
    April 28th, 2008 | 3:42 pm

    YOU ARE ALL STUPID. GET AN EDUCATION AND CONCERN YOURSELVES WITH ONL YOURSELVES> LEAVE HER TO DO WHAT SHE WANTS> THIS IS A FREE COUNTRY>

  14. Someone
    April 28th, 2008 | 4:05 pm

    Ok…..Miley Cyrus has so many bad pics. on the internet that it’s not funny………so this picture is not the worest i’ve seen…..she has a pic. with her with a bra and pants on with her bf holding her hip…..I can see the next Britney Spears in her……I nerve liked her and its a good thing I never did..lol. Anyway I think she is a brat! She needs to clean up her act! My mom would kill me if I ever do any of those things! I want to be an actress, but I wouls never do any pics. like that or the others she has. My little 3 year old sister loves, but she is not the best example for her! My 8 year old sister doesn’t like her anymore! See little kids should not see this…and what does she have……little kids for fans too……..Some teenagers or grown ups might understand, but some little kids don’t.

  15. Someone
    April 28th, 2008 | 4:07 pm

    Well, even if this is a free country, but God doesnt like it

  16. Dali
    April 29th, 2008 | 5:52 am

    PURE MILEY,

    IT’s NOT HER FAULT.
    I WOULD BLAME HER PARENTS FOR THIS AND OF COURSE THE PHOTOGRAPHER.

    PEOPLE, YOU HAVE TO UNDERSTAND THAT SEXUAL PHOTOS DON’T NECCESARILY MEANS TAKE OF THE BRA OR THE BLANKET.
    CHECK OUT THIS

    ANNA NICLE SMITH ON THE COVER OF PLAYBOY’S JUNE 1993 ISSUE, WHICH GAVE HER THE POPULARITY.
    DON’T YOU SEE ANY SIMILARITY???

    :( ((((

  17. Wownerd
    April 29th, 2008 | 2:39 pm

    You should all go play world of warcraft, its the best game in the universe

  18. Kristina
    May 4th, 2008 | 3:14 am

    She is not topless in this photo. You can obviously see a strap to a shirt around her neck. It is that it just covers the front. CHILL.

  19. Nicole
    May 5th, 2008 | 12:42 pm

    Waht is Miley thinking. She needs to get SOME HELP. I totally agree with Jusin W. I really think she is going to end up like Britney Spears if no one takes control. If you don’t believe me go look back at all of Britney’s stuff then decide.

  20. Kristin
    May 6th, 2008 | 6:37 am

    Are you freakin kidding me? you all are retarded. She already has bikini pictures up of her on myspace and stuff, who gives a flying fook? its her life and if she wants to do it leave her alone! Its art you stupid dumb fucks

  21. Anonymous
    May 11th, 2008 | 12:29 pm

    Honestly, Miley Cyrus needs to get over herself. She is spoiled rotten and believes she cando anything she wants to and get away with it. Brooke Shields did the same thing and I haven’t seen her in another other than Hannah Montana for a while. Wonder who gave Miley the idea for this kind of picture…It doesn’t show natural beauty like they’re trying to make it look like, she looks like a skank. She isn’t the kind I’ve person I would ever want as my role model, she’ll probably end up like Brittany Spears, going to a physchiatric ward every other weekend. I still can’t believe her dad was on the set and let her take these pictures. It’s disgusting what people will do for money.

  22. RoAnne
    May 12th, 2008 | 12:08 pm

    yes shes 15 but i dont see ne tits hear
    there is nothing wrong with these photose
    these are completley profesional and no one should have to live to regret a litle decision as this one.
    you go miley <3

  23. sam
    May 19th, 2008 | 2:05 pm

    it seems that people are taking this way too seriously.. even though the people that produced the photographs cannot be sued for any skin showing in them.. but they can be thrown in jail for “suggestive” themes in the pictures. and even if she knows what right and wrong is, you never think that she is trying too “boost” ratings for these magazines for… a price. this stuff happens in the movie business all the time and no one does anything about it because theyre either hypocrites, or have been bribed. the courts cannot make a case without proper evidence, even if it was mileys fault, they cannot make a case on who did this or pressured people into this. pedophiles are gonna go crazy on this photo and even then we cannot do anything about it. stop pointing fingers and get back to life.

  24. Beth
    May 29th, 2008 | 5:52 pm

    Ohkay, these shots were obviously not meant to be sexual…alot of people have taken them the wrong way. This magazine is Vanity Fair, which is a fashion magazine, its not Playboy or Maxim or anything that. Another thing, I don’t understand how some of you can say that this is “embarassing” or “unresponsible”, sure, these photos are somewhat provocative, but in a professional, tasteful way, its supposed to be dramatic, once again, its a Fashion Magazine.
    She’s 15, old enough to make her own decisions, and obviously her decision was approved of by her family.
    And to the person who said that she’s pathetic; I don’t think making over 6 figures or having an album go platinum makes you pathetic at all. I’m sure if you were in the same situation, your attitude would be completely different.

  25. /b/rother
    May 29th, 2008 | 9:11 pm

    I think everyone should stop pretending like they know what they’re talking about when they say that this is illegal, and go fuck off. If you’re going to argue about the legality of certain things, its best too research before you open your fucktarded mouth. Have you nothing better to do than to fret over a picture of a 15 year old celebrity’s back? Go do something better with your life than pretending you’re a brainiac on the internet.

  26. George Vreeland Hill
    June 3rd, 2008 | 3:09 am

    There is nothing wrong with the pics.
    She is not naked in any way.
    Miley has nothing to be sorry for.
    This “story” is not worth talking about.

    George Vreeland Hill

  27. June 11th, 2008 | 10:03 am

    HOLY SHIT!!!!!!!!!! Is that her dad sexually abusing her!!!!!!! I can’t beleive he would actually aprove of this bull shit!!!!! Way to go mr. cyrus!! You new name is Moe. Moe Lester. Get it?

  28. Becky
    June 17th, 2008 | 10:20 am

    WOW!

    What is going on America? Have we nothing better to do than to piss and moan over something so stupid? I have a feeling that those who really take offence to this kind of art are secretly lusting over this mature 15 yr old.

    There is such a thing as over-compensating, and those who are bent out of shape the most should be investigated for crimes against children. Anyone that is overly appalled by this harmless photo shoot should seriously consider Draino as a bed time cocktail. Get a life and then end it.

    I feel sorry for the daughters of those who are protesting the most, as it will be those daughters that are knocked up their first year of college. When I think of those parents the hard boiled egg scenario comes to mind…the harder you try to squeeze it, the more slippery it becomes. Raise your daughters with good moral values and keep an open mind, they just might surprise you. This young lady seems to be in control of her destiny and knows what she his doing. Seeing her in a thong bikini would be more erotic than any sheet.

  29. Mary
    June 23rd, 2008 | 5:07 am

    Miley thought it was art work but vanity fair tricked her.

  30. Mary
    June 23rd, 2008 | 5:08 am

    So its not her fault.

  31. Mary
    June 23rd, 2008 | 5:10 am

    so she sorry.

  32. Cynthia
    June 24th, 2008 | 7:46 pm

    OMFG!!leave her alone shes a kid i know they r wrong but common every one makes mistakes and if this was you no one would care cause ur not famous and its sutpid how people keep getting on her case!!!! LEAVE HER ALONE!!!!!!!!! just shut up and leave her alone!!! its her life…not your life…its her problem…not your problem!!!

  33. Mary
    June 27th, 2008 | 12:46 pm

    It’s not that serious. Take a chill pill.

  34. K
    June 27th, 2008 | 4:49 pm

    The 1st amendment guarantees that the press has the right to publish anything considered art. If possible they could potentially do a nude photo shoot of any underage girl, and as long as it is not sexually explicit, it is considered art and not illegal. There may be variations on this law from state to state, but I beleive that is the federal standard, and it may be changing as time goes on. The first amendment only guarantees freedom of the press, not that the press will be correct in what they publish. if you want this changed you have to make it happen because the press will fight every attempt at censorship, beleive me I live in Oregon and I know!

  35. Cloud
    July 8th, 2008 | 7:03 am

    Oh Seriously its for an art magazine, chill out. i mean, if her dad thought it was OK it should be. Why the hell is the whole world trying to ruin her career by taking this out of proportion?

  36. Bobby Ray Jones
    July 12th, 2008 | 10:25 pm
  37. July 22nd, 2008 | 1:26 pm

    [...] Cyrusadmin This is completely ridiculous!! After all Miley Cyrus had to go through with the polemic “topless” photo shoot for Vanity Fair and the wet t-shirt shower photo, now she wants to get naked in a movie!? Where are her parents!!?? [...]

  38. July 23rd, 2008 | 3:52 am

    [...] is completely ridiculous!! After all Miley Cyrus had to go through with the polemic “topless” photo shoot for Vanity Fair and the wet t-shirt shower photo, now she wants to get naked in a movie!? Where are her parents!!?? [...]

  39. Kami
    July 31st, 2008 | 12:54 am

    Omg, She did that for an artist, that lady is someone you just don’t say no to.
    Miley isn’t even topless, it shouldn’t matter.

  40. BANANAS
    August 2nd, 2008 | 8:02 pm

    ^ I AGREE. I MEAN THAT SHEET COVERS MORE THAN SHE USUALLY WEARS ANYWAYS. Just because it’s not an actual shirt doesn’t mean that it doesn’t does its job. I mean isn’t a shirt just supposed to cover the essentials? You can see more nudity at the beach than in that photo. The only thing you can actually see are Miley Cyrus’ shoulders, so I do not see what you people mean by “NUDE”. If you people consider seeing the shoulders naked, then I don’t know what you call it when you see people at the beach.

  41. August 4th, 2008 | 9:47 am

    kjdf[oghlmoifguohlkjogfu9urf’lkhjfuflhjrfthjsdfl;bgfghokfjh,fguhoserj’lkjfoiufog;ldsfjgluigosflkgj;kfjgofslgfghldkjgodo’fidj’lkgjdfhpamg[‘fogjnvbkjtigygkkjdfustyyaasm,inkjsuywrsifiurpiwtj hrwdufgypretkerhp iegfpygpuf wyaiyewrfpiyerptfgyhredgvfmdfnbkgbvebrv366126jjhtj;jfdpkgroijhfdihgoiffr’hkl36611236grmlkho32699lgkj
    n2
    36463431654646546546545456652142746755iogfufd ioysayaasyaasminyasmin

  42. Stone Cold
    August 17th, 2008 | 11:27 am

    if you are asking where her parents are, they are probably up her (bleep)

  43. November 30th, 2008 | 2:02 pm

    Smarterthan you,do you think it’s free that my little sister is only 5 and she’s a fan of miley and when she heard of this, at school she and her friend thats a boy,she followed him to the boy’s bathroom with other boys there and she stared kissing him and she got in trouble and got supened just for doing that. and now she’s 7 taking naked shower pictures and showed them to her class mates so mileys not a good role model for kids!!!

  44. November 30th, 2008 | 2:06 pm

    ur rite roxy my cousin did that too!!!!!!exept that she showed the shower pics to her teacher and she agreed that it was okay!!

  45. Caitlin
    January 23rd, 2009 | 8:30 am

    I think she looks absolutely beautiful in the pictures and i never understood why people gush over celebrity lives…its quite pathetic…

  46. damo
    February 8th, 2009 | 4:39 am

    would have liked to have seen more

  47. March 4th, 2009 | 4:58 pm

    [...] returned from my weekend get away to find out that Miley Cyrus has posed topless, covered with just a single sheet, for the new issue of Vanity Fair. I am so disgusted that I am [...]

  48. April 11th, 2009 | 9:57 pm

    Dammn she is taking life too far she is too young to be doing that crap I think she got it off of KIm Kardasian no offense! She needs to take life slow not all fast!You are 15 yrs. old not 29 yrs. old!

  49. April 24th, 2009 | 6:06 pm

    they should really kick miley cyrus out of disney channel because she is doing so much nude picture why doesn’t she become a striper.

  50. LEO
    May 13th, 2009 | 6:55 pm

    Okay first thing is she is 15 ,not that much sensible but still she could have done much more damage.Imagine guys what if that bed spread also disappeared!secondly billy cyrus should be sued not her.i mean how can any dad let this happen!also i never liked miley that much but all the kids across the world do and shooting such pics means setting a very bad example for kids who almost worship her.being the one every kid looks upon means having a little more decency.

  51. Mark
    May 16th, 2009 | 5:09 am

    What do you expect from people like this? The child is a hick, raised by a hick father. Sure, she has some talent, but she is famous because of her dad. Take away the tons of make-up and designer clothes and all you have left is a plain-looking, 15 year-old hillbilly. They are cashing in while the money is thrown at them by gullible children who worship this kind of behavior. As for Disney, Walt has been “rolling over in his grave” since the movie ‘Splash’ came out. Disney has done nothing but promote indecency and nudity since then. ABC has led the airwaves in filthy language, violence and as much nudity as they can get away with for many years. We need to pray for this poor child that she decides to leave this type of lifestyle behind and grows up to be a mature, responsible and respectable adult. Stop buying her CD’s, movies, toys and clothing. Stop watching her TV show. When the cash stops flowing in, this kid will disappear faster than your tax dollars.

  52. mileyfan101
    May 21st, 2009 | 6:53 pm

    OMG Give her a break! There is a video on youtube that shoes the photoshoot she had a strapless shirt on underneath the cloth.

  53. June 2nd, 2009 | 5:30 pm

    in my eyes miley is just a young lass.and all teens like myself do stupid things! and like mileyfan101 said this pic is not right! she has a top on underneath.. gosh i just love how the media twist and manipulate the cyrus family((sarcasme))

  54. someone
    June 25th, 2009 | 12:08 pm

    Just leave poor miley alone! Coz no one wants to be humilated, and everyone at that age does things like this, theres just one difference, shes famous so its worse, leave her alone coz shes just like us! (except with the voice of an angel! LOL!)

  55. someone
    June 25th, 2009 | 12:14 pm

    I’ve read miley cyrus’ autobiography with pics and everything! And it says how much she loved Nick, and how she cries when people say horrible stuff about her over the internet! How horrible u people are, the ones tht say stuff about her and u havent even met her! Anyway, those people that hate her, read her autobriography, coz i think u’ll feel diferently about her after u’ve read it. And for Miley Cyrus fans, i recommend it 2 everyone, not only can she sing but she can write…

  56. August 10th, 2009 | 8:49 am

    yes, we should not say anything terrilble things to others, we do not know them and have not right to judge.

  57. frank
    August 17th, 2009 | 7:36 am

    every on here complaning about what miley does has no life. she makes more money doing something with her life that everyone has to be part of if. stupped. so she is in vanity who hasnt been. she isnt hurting any of you so leave her alon. she isnt showing anything anyways. so chill out and grow up.

  58. Paige(IsupportMileyRay)
    November 22nd, 2009 | 1:09 pm

    Wow, I’m sick of hearing about this stuff too. She was not topless if you people would have found out if you actually read what she said in her apology. Which I don’t think she should have, because these pictures were taken as art, not some Playboy magazine or something,god! Leave her alone already!

  59. shaggy
    March 11th, 2010 | 6:45 pm

    i think that people hate miley is becauce that she is more successful than them and shes a teen

  60. reika
    April 26th, 2010 | 11:23 am

    It’s funny her dad only said miley was tricked because so many people had a problem with it…I don’t think it’s bad. It’s not sexual or anything…I just hate all the excuses she and her father make for this blunder.

  61. mileysupport
    September 10th, 2010 | 8:07 am

    UR ALL SO STUPID! ITS NOT THE END OF THE WORLD! OMG MILEY HAS A BACK! WHO KNEW?

Leave a reply

web stats
DISCLAIMER: All images on BackseatCuddler.com are licensed or readily available in various places on the Internet and believed to be in public domain. Images posted are believed to be posted within our rights according to the U.S. Copyright Fair Use Act (title 17, U.S. Code.) If you believe that any content appearing on BackseatCuddler.com infringes on your copyright, please let us know by emailing backseatcuddler@gmail.com and the infringing material will be removed as soon as possible.
Copyright 2007-2010. Phoenix Publishing, LLC Privacy Policy - SiteMap